TWINSLAWNSERVICE.MANAGEANDPAYMYACCOUNT.COM SERVER
I identified that a lone page on twinslawnservice.manageandpaymyaccount.com took five thousand two hundred and nineteen milliseconds to stream. Our web crawlers identified a SSL certificate, so we consider this site secure.
Internet Protocol
72.32.53.127
SERVER OS
We identified that this domain is operating the Microsoft-IIS/8.5 operating system.HTML TITLE
Manage Your AccountDESCRIPTION
Your privacy and security are important. The browser you are using is not supported. We recommend using Google Chrome or Mozilla Firefox. If you have not set up account to be accessed online please contact us at 508-459-1534. Enter your email address below if you have forgotten your password. We will send you an email with your login information. Thank you for using our online account management solution! If you have any questions or concerns you may contact us by email by clicking here.PARSED CONTENT
The domain twinslawnservice.manageandpaymyaccount.com had the following on the site, "Your privacy and security are important." We analyzed that the webpage said " The browser you are using is not supported." It also stated " We recommend using Google Chrome or Mozilla Firefox. If you have not set up account to be accessed online please contact us at 508-459-1534. Enter your email address below if you have forgotten your password. We will send you an email with your login information. Thank you for using our online account management solution! If you have any questions or concerns you may contact us by email by clicking here."