Manage Your Account
OVERVIEW
JAMESLAWNSERVICE.MANAGEANDPAYMYACCOUNT.COM TRAFFIC
Date Range
Date Range
Date Range
LINKS TO DOMAIN
WHAT DOES JAMESLAWNSERVICE.MANAGEANDPAYMYACCOUNT.COM LOOK LIKE?
JAMESLAWNSERVICE.MANAGEANDPAYMYACCOUNT.COM SERVER
SERVER OS
We identified that this domain is operating the Microsoft-IIS/8.5 operating system.HTML TITLE
Manage Your AccountDESCRIPTION
Your privacy and security are important. The browser you are using is not supported. We recommend using Google Chrome or Mozilla Firefox. If you have not set up account to be accessed online please contact us at 770-271-7639. Enter your email address below if you have forgotten your password. We will send you an email with your login information. Thank you for using our online account management solution! If you have any questions or concerns you may contact us by email by clicking here.PARSED CONTENT
The domain jameslawnservice.manageandpaymyaccount.com had the following on the site, "Your privacy and security are important." We analyzed that the webpage said " The browser you are using is not supported." It also stated " We recommend using Google Chrome or Mozilla Firefox. If you have not set up account to be accessed online please contact us at 770-271-7639. Enter your email address below if you have forgotten your password. We will send you an email with your login information. Thank you for using our online account management solution! If you have any questions or concerns you may contact us by email by clicking here."SEEK OTHER DOMAINS
We are the Boston College Computer Science Society. Join our Email list to recieve updates on upcoming events. We organize tech talks with interesting developers and programmers. We organize workshops and monthly project nights for students of all skill levels to build and learn new skills. We sometimes hit the road and go to hackathons at other colleges. Our upcoming talks and workshops! Our past talks and workshops! IBM Cyber Security Series.
New beachside, modern home now available for holiday rental, download our pricelist. Welcome to Pagham Beach House, your opportunity to stay in our award-winning, architect designed, modern home. Built on a shingle beach, the house is 40 meters from the sea. With one large living, dining and kitchen room, guests can enjoy panoramic views with all the comforts of modern living. These are the facilities and services included in the price of your holiday. Garage and one parking space.
We manage and install all types of server hardware. If you are not virtual yet, you should be! Do you need assistance in managing your server operating systems? We can help in many ways, from managing your Active Directory, SQL servers, or even SharePoint.
Welcome to Rouge - Pole and Lap Dancing Club. We offer a wide variety of services and packages to suit everyone and all occasions. Our live DJ will also entertain you with her saucy humour, sexy tunes and her spectacular stag on stage show. A must for every lads weekend. Club info and opening times.